PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G013600.2
Common NamePHAVU_003G013600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 297aa    MW: 31435.8 Da    PI: 6.8677
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G013600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.97.5e-111155345
                        SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                         W+ e d+ + +a + ++ +   +W++Ia+ ++ g+t +++k ++ 
  Phvul.003G013600.2 11 EWSREQDKAFENALATHPEDasdRWEKIAADVP-GKTIEEIKQHYE 55
                        7********************************.**********95 PP

2Myb_DNA-binding43.85.9e-14122166347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT++E+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
  Phvul.003G013600.2 122 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 166
                         6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.934762IPR017884SANT domain
SMARTSM007171.6E-9860IPR001005SANT/Myb domain
SuperFamilySSF466893.59E-111066IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-51155IPR009057Homeodomain-like
PfamPF002495.3E-91155IPR001005SANT/Myb domain
CDDcd001671.90E-91158No hitNo description
PROSITE profilePS5129417.61114171IPR017930Myb domain
SuperFamilySSF466898.61E-17117172IPR009057Homeodomain-like
SMARTSM007174.5E-11119169IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.5E-17119169IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.2E-11122165IPR009057Homeodomain-like
PfamPF002497.4E-12122166IPR001005SANT/Myb domain
CDDcd001671.29E-10122167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MTVDEVDSSS EWSREQDKAF ENALATHPED ASDRWEKIAA DVPGKTIEEI KQHYELLVED  60
VSQIESGCVP LPSYNSSSEG STSHASDEGA GKKGSGLGNY NSESNHGTKA SRSDQERRKG  120
IAWTEDEHRL FLLGLEKYGK GDWRSISRNF VVTRTPTQVA SHAQKYFIRL NSMNKDRRRS  180
SIHDITSVNN GDVLAPQGPI TGQTNGSAAN STAKATKQGT PASTGVPGVG IYAAPTIGQP  240
VGGPLVSAVG TPVNLPSPAH MAYGVRAPVA GAVVPGAPVN VIPVTYAMPH TSAPHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1912771176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153178.10.0hypothetical protein PHAVU_003G013600g
RefseqXP_007153179.10.0hypothetical protein PHAVU_003G013600g
RefseqXP_007153180.10.0hypothetical protein PHAVU_003G013600g
SwissprotQ8S9H72e-65DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV7C7500.0V7C750_PHAVU; Uncharacterized protein
STRINGGLYMA07G28310.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-120MYB family protein